SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003638
Domain Number 1 Region: 47-264
Classification Level Classification E-value
Superfamily EF-hand 1.97e-64
Family Penta-EF-hand proteins 0.0000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003638   Gene: ENSGGOG00000003699   Transcript: ENSGGOT00000003721
Sequence length 266
Comment pep:known_by_projection chromosome:gorGor3.1:19:33450527:33460623:1 gene:ENSGGOG00000003699 transcript:ENSGGOT00000003721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGTAMRIL
GGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMN
ILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFD
TDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRA
FKSLDRDGTGQIQVNIQEWLQLTMYS
Download sequence
Identical sequences G3QMA3
ENSGGOP00000003638 XP_018871481.1.27298 XP_018871482.1.27298 ENSGGOP00000003638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]