SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003688 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003688
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-46
Family Galectin (animal S-lectin) 0.000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003688   Gene: ENSGGOG00000003754   Transcript: ENSGGOT00000003775
Sequence length 132
Comment pep:known_by_projection chromosome:gorGor3.1:22:21903612:21912849:-1 gene:ENSGGOG00000003754 transcript:ENSGGOT00000003775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGELEVKNMDMKPGSTLKITGRIADGTDSFVINLGQGTDKLNLHFNPRFSESTIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVR
GGFNMSSFKLKE
Download sequence
Identical sequences G3QME9
ENSGGOP00000003688 ENSGGOP00000003688 XP_004063485.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]