SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003696
Domain Number 1 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 866-923
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 21-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 780-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.2e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 676-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 730-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 14 Region: 978-1030
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 15 Region: 922-977
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 16 Region: 164-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000142
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 17 Region: 827-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000298
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003696   Gene: ENSGGOG00000007250   Transcript: ENSGGOT00000003783
Sequence length 1036
Comment pep:known_by_projection chromosome:gorGor3.1:19:22996190:23012570:-1 gene:ENSGGOG00000007250 transcript:ENSGGOT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFWSEKCTRLILYDLKIALKNGSLTFRDVTIEFSLEEWQCLDTAQQNLYRNVMLENYRN
MVFLGIAVSKLDLITCLKQGKEPWNMKRHEMVTKPPVISSHFTQDFWPDQSIKDSFQEII
LRTYARCGHKNLRLRKDCESVNEGKMYEEGYNKLNQCWTTTQGKIFQCNKYVKVFHKYSN
SNRHKRIHSGEKYFKCEECGKAFNFSNVTTHDRIHNGVKPFKCEECCKAFNQFYKLTVHK
RIHNGEKPYKCEECGKAFNHSSILRNHKIIHSEKKPYKCEECGKAFNNSSTLMKHKIIHT
GKKPYKCEECGKTFKQSSHLTRHKAIHTGEKPYKCEECGKAFKRFSALRKHQIIHTGKKP
YKYEECGKAFSNLSALRKHEIIHTGEKPYKCEECGKAFQWSSKLTIHKVIHTAEKPCKCE
ECGKTFKRFSALRKHKIIHTGKQPYKCEECSKAFSNFSALRKHEIIHTGEKPYKCECGKA
FKWSSKLTVHKVIHMEEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNS
STLIKHKIIHTGKKPYKCEECGKAFKQSSHLTRRKAIHTGEKPYKCEECGKAFKHFSALR
KHQIIHTGKKPYKCEECGKAFSQSSTLRKHEIIHTGEKPYKCEECGKAFKWSSHLTRHKV
IHTKEKPYKCEECGKAFNHFSALRKHKIIHTGKKPYKCEECDKAFSQSSTLRKHEIIHTG
EKPYKCEECALRKHKIIHTGKKPYKCEECGKAFNNSSTLRKHEIIHTGEKPYKCEECGKA
FQWSSKLTLHKVIHTGEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNS
STLLKHKIIHTGKKPYKCEECECGKAFSNFSALRKHKIIHTGEKSYKCEECGKAFSNFSA
LRKHKIIHTGEKPYKCEECGKAFKWSSKLMEHKVIHTVEKPCKCEECGKAFKHFSALRKH
EIIHTGKKPYNCEECGEKPYKCEECGKAFKQSSHLTKHKAIHTGEKPYKCEECGKAFSHF
SCLTKHRIIHTGKKPY
Download sequence
Identical sequences ENSGGOP00000003696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]