SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003713 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003713
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-55
Family Lectin leg-like 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003713   Gene: ENSGGOG00000003780   Transcript: ENSGGOT00000003800
Sequence length 261
Comment pep:novel chromosome:gorGor3.1:5:161934203:161940601:1 gene:ENSGGOG00000003780 transcript:ENSGGOT00000003800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEQPILLSLQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFH
GLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFL
AVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQ
LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIV
VCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences ENSGGOP00000003713 ENSGGOP00000003713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]