SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003722
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily EF-hand 5.44e-24
Family Calmodulin-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003722   Gene: ENSGGOG00000003788   Transcript: ENSGGOT00000003809
Sequence length 179
Comment pep:known_by_projection chromosome:gorGor3.1:22:13812023:13816187:1 gene:ENSGGOG00000003788 transcript:ENSGGOT00000003809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVT
LLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMT
EEESHLGTAEECPVDVETCSNQQIRQTCVRKSLICAFAIAFIISVMLIAANQVLRSGMK
Download sequence
Identical sequences F1MWD4 F7DH31 G1TFR4
ENSGGOP00000003722 ENSECAP00000017738 ENSOCUP00000015758 ENSOCUP00000015758 ENSECAP00000017738 ENSBTAP00000023774 ENSGGOP00000003722 9796.ENSECAP00000017738 9913.ENSBTAP00000023774 9986.ENSOCUP00000015758 ENSBTAP00000023774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]