SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003736
Domain Number 1 Region: 321-640
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.77e-127
Family Mammalian PLC 0.0000000000389
Further Details:      
 
Domain Number 2 Region: 160-316
Classification Level Classification E-value
Superfamily EF-hand 1.57e-45
Family EF-hand modules in multidomain proteins 0.000000679
Further Details:      
 
Domain Number 3 Region: 650-775
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-32
Family PLC-like (P variant) 0.00000335
Further Details:      
 
Domain Number 4 Region: 35-150
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-28
Family Pleckstrin-homology domain (PH domain) 0.000000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003736   Gene: ENSGGOG00000003801   Transcript: ENSGGOT00000003824
Sequence length 777
Comment pep:known_by_projection chromosome:gorGor3.1:3:39036711:39054350:-1 gene:ENSGGOG00000003801 transcript:ENSGGOT00000003824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCLGIRSRSRSRELYLQEQSLKVAALNGRRLGLQDDEDLQALLKGSQLLKVKSSSWRRE
RFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSI
VFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNK
MSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFA
EAAGSGETLSVDQLVTFLQHQQREEVAGPALALSLIERYEPSETAKAQRQMTKDGFLMYL
LSADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRC
LELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQR
VMARHLHAILGPMLLNRPLDGVTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVV
SDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYE
MASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNF
QTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQ
QLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLAL
VRFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
Download sequence
Identical sequences G3QMJ5
ENSGGOP00000020610 ENSGGOP00000003736 XP_004033889.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]