SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003758
Domain Number 1 Region: 36-295
Classification Level Classification E-value
Superfamily Thiolase-like 1.73e-69
Family Thiolase-related 0.00000568
Further Details:      
 
Domain Number 2 Region: 300-421
Classification Level Classification E-value
Superfamily Thiolase-like 1.73e-41
Family Thiolase-related 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003758   Gene: ENSGGOG00000003822   Transcript: ENSGGOT00000003848
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:3:39165299:39183222:-1 gene:ENSGGOG00000003822 transcript:ENSGGOT00000003848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLHVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN
Download sequence
Identical sequences G3QML6
XP_004033892.1.27298 ENSGGOP00000003758 ENSGGOP00000003758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]