SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003772
Domain Number 1 Region: 264-442,480-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.48e-80
Family YicI catalytic domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 1178-1326,1371-1532
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.32e-56
Family YicI catalytic domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 17-261
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.28e-46
Family YicI N-terminal domain-like 0.0098
Further Details:      
 
Domain Number 4 Region: 886-1129
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-36
Family YicI N-terminal domain-like 0.028
Further Details:      
 
Domain Number 5 Region: 1535-1615
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.18e-20
Family Putative glucosidase YicI, domain 3 0.0092
Further Details:      
 
Domain Number 6 Region: 645-725
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.32e-20
Family Putative glucosidase YicI, domain 3 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003772   Gene: ENSGGOG00000003832   Transcript: ENSGGOT00000003863
Sequence length 1756
Comment pep:novel chromosome:gorGor3.1:7:140489050:140549491:1 gene:ENSGGOG00000003832 transcript:ENSGGOT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADISL
KSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQ
LYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRS
YRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLP
ALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIAS
LYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAIS
GNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKLYRAYVAFPDFFRNSTAKWWKREIEELY
NNPQDPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTL
CMENGSPVQHYNVHNLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNT
AAWDQLKKSIIGMMEFSLFGISYTGADICGFFEDAEYEMCVRWMQLGAFYPFSRNHNTIG
TRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTW
DIDSQFLLGPAFLVSPVLERNTRNVTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHIN
LHVRGGYILPWQEPALNTHLSRKNPLGLIIALDENKEAKGELFWDDGQTKDTVANKVYLL
CEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDS
NLKVAIITDIDLLLGEAYTVEWGIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSG
VPFCYFVNDLYSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQF
KIYDPNNNRYEVPVPLNIPSVPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLG
FTFSDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPPGVRTEHLGSVSL
LLSTQTAHALGFIFPNSTFSDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTEIC
ALPCFLPFLSHDFKTCSQNVLGSIRINNIHSSFTPHVLPQDVQYSDIDYMERQLDFTLSP
KFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGIEDDVFIKYPNDGDIVWGK
VWPDFPDVVVNGSLDWDSQVEKSRGEDLFWEFFLRNISWFSGQVLFNSYNVKSASNYNWQ
DDMNEPSSFVNGAVSPGCGDASLNHPPYMPHLESRDRGLSSKTLCMESEQILPDGSPVQH
YNVHNLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSI
IGMMEFSLFGISYTGADICGFFEDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWD
AAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGP
AFLVSPVLERNARNVTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILP
WQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTM
QSHIIFNNYITGTNPLKLGYIEIWGVGSVPITSVSISVSGMVITPSFNNDRTTQVLSIDV
TDRNISLHNFTSLTWI
Download sequence
Identical sequences ENSGGOP00000003772 ENSGGOP00000003772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]