SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003811 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003811
Domain Number 1 Region: 29-199
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.53e-51
Family MHC antigen-recognition domain 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003811   Gene: ENSGGOG00000007925   Transcript: ENSGGOT00000003906
Sequence length 252
Comment pep:novel chromosome:gorGor3.1:6:151002446:151007800:-1 gene:ENSGGOG00000007925 transcript:ENSGGOT00000003906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAAAIPALLLCLPLLFLLFGWSRAGRDDPHSLCYDITIIPKFRPGPRWCAVQGQVDKKT
FLHYDCGNKTVTPVSPLGNKLNVTKSWKAQNPVLRKVVDILTEQLLDIQQENYTHKEPLT
LQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTMVHPEARKMKEMWENDKDVAM
SFHYISMGDCAGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATSLILCCLLHPPLL
HLPWHLRRVLSD
Download sequence
Identical sequences ENSGGOP00000003811 ENSGGOP00000003811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]