SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003813
Domain Number 1 Region: 15-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.89e-32
Family PB1 domain 0.00000576
Further Details:      
 
Domain Number 2 Region: 128-250
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-22
Family PDZ domain 0.00000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003813   Gene: ENSGGOG00000003886   Transcript: ENSGGOT00000003908
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:16:57895682:57897381:1 gene:ENSGGOG00000003886 transcript:ENSGGOT00000003908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQ
GPPCWDLHPGCRRPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL
Download sequence
Identical sequences ENSGGOP00000003813 ENSGGOP00000003813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]