SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003885 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003885
Domain Number 1 Region: 243-344
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.27e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 97-208
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 16-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000611
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003885   Gene: ENSGGOG00000003957   Transcript: ENSGGOT00000003981
Sequence length 605
Comment pep:known_by_projection chromosome:gorGor3.1:14:42668724:42719850:1 gene:ENSGGOG00000003957 transcript:ENSGGOT00000003981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGGANDKKNRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASV
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTEC
VLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTE
TDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLE
PNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEGTLLQQPDDHAATTSLSWKRVKGCKSS
EQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRA
LDQVN
Download sequence
Identical sequences ENSGGOP00000003885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]