SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003937 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003937
Domain Number 1 Region: 1792-2038
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.79e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 492-621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 384-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000463
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 883-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000518
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 754-887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000816
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 1146-1280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 920-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 985-1125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000124
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 729-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 616-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000572
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 11 Region: 117-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 232-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 263-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000013
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 153-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 15 Region: 36-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000504
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 654-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000748
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 17 Region: 1396-1428
Classification Level Classification E-value
Superfamily Notch domain 0.000000101
Family Notch domain 0.0015
Further Details:      
 
Domain Number 18 Region: 1278-1316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1348-1387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 20 Region: 194-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 21 Region: 80-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 22 Region: 1475-1506
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 688-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000293
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003937
Domain Number - Region: 1438-1469
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0086
Further Details:      
 
Domain Number - Region: 1125-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003937   Gene: ENSGGOG00000004007   Transcript: ENSGGOT00000004034
Sequence length 2443
Comment pep:known_by_projection chromosome:gorGor3.1:1:123102715:123260718:-1 gene:ENSGGOG00000004007 transcript:ENSGGOT00000004034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPALLWALLALWLCCAVPAHCPEGLLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKA
TCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDAC
LSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQ
CPQGFTGQYCDSLYVPCAPSPCVNGGICRQTGDFTFECNCLPGFEGSTCERNIDDCPNHR
CQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVN
GWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGA
LCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGY
AGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQ
CVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCE
ENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNG
YQCNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECAS
NPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAG
WVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQG
TCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQ
RCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVD
GVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNI
NECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYR
CSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIA
ASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFI
GGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDD
CARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY
LCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQ
VKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSG
SRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSS
PLPCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECG
WDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELM
VYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAA
LLASHAIQGTLSYPLVSVVSESLTPERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGS
LWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKK
VKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVRGPDG
CTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYS
RADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPL
ILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDN
KEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVT
PSPPGTVLTSALSPVICGPNRSFLSLKHTPMGKKSRRPSAKSTMPTSLPNLAKEAKDAKG
SRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAA
PPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVP
VPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQ
LIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQVPEMARLPSVAFPTAMMPQQDGQVAQT
ILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSS
SPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA
Download sequence
Identical sequences ENSGGOP00000003937 ENSGGOP00000016493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]