SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003989 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003989
Domain Number 1 Region: 9-93
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.61e-31
Family Non-canonical RBD domain 0.00016
Further Details:      
 
Domain Number 2 Region: 97-207
Classification Level Classification E-value
Superfamily L domain-like 5.36e-17
Family mRNA export factor tap 0.0000561
Further Details:      
 
Domain Number 3 Region: 241-307
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000286
Family NTF2-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003989   Gene: ENSGGOG00000004059   Transcript: ENSGGOT00000004086
Sequence length 352
Comment pep:known_by_projection chromosome:gorGor3.1:X:99089662:99098113:-1 gene:ENSGGOG00000004059 transcript:ENSGGOT00000004086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRNTQDENMRKFKVTIPYGIKYDKAWLMNSIQSHCSVPFTPVDFHYIRNRTCFFVQVAS
AASALKDVSYKIYDDENQKICIFVNHFTAPYSVKNKLKPGQMEMLKLTMNKWYNVSQQAL
DLQNLRFDPDLMGRDIDIILNQRNCMTATLKIIERNFPELLSLNLCNNKLYHLDGLSDII
EKAPKVKTLNLSKNKLESATQDFCLDGRELSAPMIVDIDSSEIMESYTGSETLKSIVLFL
QQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPRNVDSLSALPETQRDFSSILVDAWCQ
TVNTCFLPRAGPESQRWWCLLSLKWKDGLRVLILPSCGPSSLPLAAIPVCAS
Download sequence
Identical sequences ENSGGOP00000003989 ENSGGOP00000003989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]