SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004003 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004003
Domain Number 1 Region: 17-117,306-610
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.2e-66
Family Integrin alpha N-terminal domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 138-328
Classification Level Classification E-value
Superfamily vWA-like 1.93e-49
Family Integrin A (or I) domain 0.0000000099
Further Details:      
 
Domain Number 3 Region: 610-766
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-29
Family Integrin domains 0.0093
Further Details:      
 
Domain Number 4 Region: 767-872
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-22
Family Integrin domains 0.0042
Further Details:      
 
Domain Number 5 Region: 891-1030
Classification Level Classification E-value
Superfamily Integrin domains 0.000000152
Family Integrin domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004003   Gene: ENSGGOG00000004075   Transcript: ENSGGOT00000004100
Sequence length 1066
Comment pep:known_by_projection chromosome:gorGor3.1:16:32035030:32105922:1 gene:ENSGGOG00000004075 transcript:ENSGGOT00000004100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTACGPTVHQTCSENTYVKGLCFLF
GSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSINPYDFRRMKEFVSTVMEQLKKSKTL
FSLMQYSEEFWIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGAR
KNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASK
PPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAITSNGPLL
STVGSYDWAGGVFLYTSNEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLVLGAPRY
QHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDNNGSTDLVLIGAPHYYEQT
RGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEE
DNRGAVYLFHGTSGFGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQ
GHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLR
EGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPNCIEDPV
SPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDLSITFSF
MSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLGLSYRKVSRLQNQRSQRSWRLA
CESASSIEVSGALKSTSCSINHPIFPENSEENNMPRTNKTEFQQELPVKYAVYMVVTVSN
LGQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPV
VNCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVF
TLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLMLLALITA
Download sequence
Identical sequences ENSGGOP00000004003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]