SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004005 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004005
Domain Number 1 Region: 14-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-44
Family G proteins 0.0000954
Further Details:      
 
Domain Number 2 Region: 171-270
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-18
Family Chaperone J-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004005   Gene: ENSGGOG00000004081   Transcript: ENSGGOT00000004102
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:2a:25331931:25361128:-1 gene:ENSGGOG00000004081 transcript:ENSGGOT00000004102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHI
RDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGP
HGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYI
SIVDLCENGGKRPTTNSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKL
AVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK
Download sequence
Identical sequences G3QN94
ENSGGOP00000004005 ENSGGOP00000004005 XP_004028981.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]