SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004058 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004058
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily Hook domain 4.71e-29
Family Hook domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004058
Domain Number - Region: 728-773
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0637
Family SNARE fusion complex 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004058   Gene: ENSGGOG00000004129   Transcript: ENSGGOT00000004156
Sequence length 986
Comment pep:known_by_projection chromosome:gorGor3.1:11:61153989:61165071:1 gene:ENSGGOG00000004129 transcript:ENSGGOT00000004156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGKGPRLRDFLSGSLATWALGLAGLVGEAEDSEGEEEEEEEEPPLWLEKRFLRLSDGA
LLLRVLGIIAPSSRGGPRMLRGLDGPAAWRVWNLNHLWGRLRDFYQEELQLLILSPPPDL
QTLGFDPLSEEAVEQLEGVLRLLLGASVQCEHRELFIRHIQGLSLEVQSELAAAIQEVTQ
PGAGMVLALSGPEPGELAPAELEMLSRSLMGTLSKLARERDLGAQRLAELLLEREPLCLR
PEAPSRAPAEGPSHHLALQLANAKAQLRRLRQELEEKAELLLDSQAEVQGLEAEIRRLRQ
EAQALSGQAKRAELYREEAEALRERAGRLPRLQEELRRCRERLQAAEACKSQLEEERVLS
GVLEASKALLEEQLEAARERCARLHETQRENLLLRTRLGEAHAELDSLRHQVDQLAEENV
ELELELQRSLEPPPGSPGEAPLAGAAPSLQDEVREAEAGRLRTLERENQELRGLLQVLQG
QPGGQHPLLEAPREDPVLPVLEEAPQTPVASHHSPQGLVQKARDGGPQALDLAPPALDSV
LEASAECPQAPDSDPQEAESPLQAAAMDPQASDWSPQESGSPVETQESPEKAGRRSSLQI
PASVAPPQGPGTKIQAPQLLGGETEGREAPQGELVPEARGLRQEGPEHKPGPSEPSSVQL
EEQEGPNQCLDLATRQTEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQAWEGPIPGESL
ASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQDTEAARLSKELAQARRAEAEAH
REAEAQAWEQARLREAVEAAGRELESASQEREALVEALAAAGRERRQWEREGSRLRAQSE
AAEERMQALESEGRQHLEEAERERREKEALQAELEKAVVRGKELGARLEHLQRELEQAAL
ERQEFLREQESQHQRYQGLEQRLEAELQAAATSKEEALMELKTRALQLEEELFQLRQGPA
GLGPKKRAEPRLVETQNVRLIEVERS
Download sequence
Identical sequences ENSGGOP00000004058 ENSGGOP00000004058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]