SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004080 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004080
Domain Number 1 Region: 79-259
Classification Level Classification E-value
Superfamily vWA-like 3.26e-39
Family Integrin A (or I) domain 0.00066
Further Details:      
 
Domain Number 2 Region: 1424-1627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.51e-38
Family Pentraxin (pentaxin) 0.00097
Further Details:      
 
Domain Number 3 Region: 2147-2216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-19
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 4 Region: 2834-2903
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-18
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 5 Region: 3242-3311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 2776-2845
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1964-2032
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 2382-2452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 9 Region: 1848-1917
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 2266-2334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1790-1859
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.1e-16
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 12 Region: 1691-1749
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 13 Region: 2892-2961
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2557-2624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 2674-2729
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 1906-1971
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000107
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2719-2781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 3419-3478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 2441-2510
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 3301-3367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 21 Region: 2499-2560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 22 Region: 2951-3013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 437-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 3066-3128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1634-1702
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 376-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 2325-2393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000106
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 28 Region: 2207-2271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 3010-3076
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 30 Region: 2021-2089
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 31 Region: 3360-3428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 3124-3187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 33 Region: 1303-1420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 34 Region: 987-1131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000328
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 35 Region: 1230-1273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000659
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 36 Region: 3184-3247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 37 Region: 2086-2153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000334
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 38 Region: 1269-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000352
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 39 Region: 1195-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000959
Family EGF-type module 0.015
Further Details:      
 
Domain Number 40 Region: 1744-1787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000936
Family EGF-type module 0.054
Further Details:      
 
Domain Number 41 Region: 496-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 42 Region: 277-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000113
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004080
Domain Number - Region: 3470-3506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000196
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 3509-3538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000311
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3538-3569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000454
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 727-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000903
Family Complement control module/SCR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004080   Gene: ENSGGOG00000004135   Transcript: ENSGGOT00000004180
Sequence length 3574
Comment pep:known_by_projection chromosome:gorGor3.1:9:92799696:93022753:-1 gene:ENSGGOG00000004135 transcript:ENSGGOT00000004180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPETAPGAPGSIPAPPAPGDEAAGSR
VERLGQAFRRRVRLLRELSERLELVFLVDDSSSVGEVNFRSELMFVRKLLSDFPVVPTAT
RVAIVTFSSKNYVVPRVDYISTRRARQHKCALLLQEIPAISYRGGGTYTKGAFQQAAQIL
LHARENSTKVVFLITDGYSNGGDPRPIAASLRDSGVEIFTFGIWQGNIRELNDMASTPKE
EHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMASCKCGTHT
GHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPGSTSPEDC
VCREGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIILC
LPNGLWSGSESFCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTC
QGNSQWDGPEPRCVERHCSTFQTPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKE
MLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSANVTWQIPTAKDNSGEK
VSVHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVMDVEPPVIDWCRSPPPIQ
VSEKVHAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHI
VIKGSPCEIPFTPVNGDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGIWKPTY
TTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFEMTLGKMVPSFCSDAEDI
DCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS
SRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKD
PMYSFQLASEILVADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYNLEHFTCESCRI
GSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPK
FGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFC
LACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSRVFHECFFN
PCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGICKDLVGEFICECPSG
YTGQRCEENINECSSSPCLNKGICVDGVSGYRCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGKRCETEQSTGFNLDFEVSGIYGYVM
LDGVLPSLHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLTDYNGWVLYVNGREKIT
NCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSVGLPIPGIFCGGALVLGQEQ
DKKGEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVG
KVKIDSKSIFCSDCPRLGGSVPHLRTASEDLKPGSKINLFCDPGFQLVGNPVQYCLNQGQ
WTQPLPHCERISCGVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWN
GVSPSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDGKNCAEPIKCKAPGNPEN
GHSSGEIYTVGAEVTFSCQEGYQLMGVTKIACLESGEWNHLIPYCKAVSCGKPAIPENGC
IEELAFTFGSKVTYRCNKGYTLAGDKESSCLANSSWSHSPPVCEPVTCSSPENINNGKYI
LSGLTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGN
NFTFRNTVTYTCKEGYTLAGLDTIECLADGKWSRSDQQCLAVSCDEPPIVDHASPETAHR
LFGDIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESV
SKAKFAAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYA
SGSNYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSSPIPTCHPVSCGEPPKVENGFLEH
TTGRIFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNGFMKG
ENFEVGSKVQFFCNEGYELVGDSSWTCQKSGKWNKKSNPKCMPAKCPEPPLLENQLVLKE
LTTEVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPLISFGVPVPSSA
LHFGSTVKYSCVGGFFLRGNSTTVCQPDGTWSSPLPECVPVECPQPEEIPNGIIDVQGLA
YLSTALYTCKPGFELVGNTTTLCGENGHWLGGKPTCKAIECLKPKEILNGKFSYTDLHYG
QTVTYSCNRGFRLEGPSALTCLETGDWDVDAPSCNAIHCDSPQPIENGFVEGADYSYGAI
IIYSCFPGFQVAGHAMQTCEESGWSSSIPTCMPIDCGLPPHIDFGDCTKLKDDQGYFEQD
DDMMEVPYVTPHPPYHLGAVAKTWENTKEAPATHSSNFLYGTMVSYTCNPGYELLGNPVL
ICQEDGTWNGSAPSCISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILVGSDLRLC
LENRKWSGASPRCEAISCKKPNPIMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQD
DKNWDEDEPICIPVDCGSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRVCLANG
SWSGATPDCVPVRCATPPQLANGVMEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNW
DAEIPLCKPVNCGPPEDLAHGFPNGFSFIHGGHIQYQCFPGYKLHGNLSRRCLSNGSWSG
SSPSCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCFKGFKLLGLSEITCEANGQWSSGFP
HCEHTSCGSLPMIPNAFINETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVC
EPLSCGSPPSVANAVATGEAHTYESEVKLRCLEGYTMDTATDTFTCQKDGRWFPERISCS
PKKCPLPENITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWEPPFSDESCS
PVSCGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKET
RCETPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLCKPNPC
PVPFVIPENALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCG
PPAHVENAIARGVHYQYGDRITYSCYSGYMLEGSLRSVCLENGTWTSPPICRAVCRFPCQ
NGGICQRPNACSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQ
SPCLNGGKCVRPNRCHCLSSWTGHNCSRKRRTGF
Download sequence
Identical sequences ENSGGOP00000004080 ENSGGOP00000017311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]