SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004088 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004088
Domain Number 1 Region: 10-116
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000027
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 311-356
Classification Level Classification E-value
Superfamily RING/U-box 0.000000294
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 248-285
Classification Level Classification E-value
Superfamily SAP domain 0.0000549
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004088   Gene: ENSGGOG00000004166   Transcript: ENSGGOT00000004188
Sequence length 363
Comment pep:known_by_projection chromosome:gorGor3.1:5:48999872:49084857:1 gene:ENSGGOG00000004166 transcript:ENSGGOT00000004188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARK
QTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDIST
EMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSS
SAQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRAS
LSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAE
DQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV
FRS
Download sequence
Identical sequences G3QNH3 Q8WZ73
gi|62865649|ref|NP_001017368.1| ENSP00000326170 ENSP00000378096 ENSP00000389832 ENSP00000412322 ENSGGOP00000004088 ENSP00000268850 NP_001017368.1.87134 NP_001017368.1.92137 XP_004041982.1.27298 XP_018883181.1.27298 9606.ENSP00000326170 ENSP00000326170 ENSP00000378096 ENSP00000389832 ENSP00000412322 ENSGGOP00000004088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]