SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004098 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004098
Domain Number 1 Region: 21-227
Classification Level Classification E-value
Superfamily L domain-like 4.88e-25
Family Internalin LRR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004098   Gene: ENSGGOG00000004178   Transcript: ENSGGOT00000004199
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:8:65244872:65298671:-1 gene:ENSGGOG00000004178 transcript:ENSGGOT00000004199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDN
CISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRE
LHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDIRDLEILENLNQLIAVDNQL
LHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLEFLDGKEIKNIERQFLM
NWKASKDAKKISKKRSSKNEDASNSLISNFKTMHHIVPVYPQVGKPKLVFFSEIQRYPVN
GNASPESSCPFWPNIERKNLSLKQSESLLTKNDVHEPHLFHNPEEKENLFVENE
Download sequence
Identical sequences ENSGGOP00000004098 ENSGGOP00000004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]