SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004102 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004102
Domain Number 1 Region: 504-600
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000187
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004102
Domain Number - Region: 1085-1141
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00863
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004102   Gene: ENSGGOG00000004171   Transcript: ENSGGOT00000004203
Sequence length 1404
Comment pep:known_by_projection chromosome:gorGor3.1:1:151811355:151886487:1 gene:ENSGGOG00000004171 transcript:ENSGGOT00000004203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFLARPFLSTNQHLAWGSPLPQGNGLVQLPSQPSRHSRPFHELCSKEENSATVPKLLS
LVVSSETIDFSNKTMDSRRDWEREKRILEGKLQLPKALARTQRAGDEGRRAWTSRWPQQR
RSPESCEAPLSAPLWGPQRGLPGREPLRSRSASAIALRTIGHILALLLRLLHLGLGSGGC
REDVPPSGRGKKEEKMKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYAQDD
NCALENEDVQFQKKNTESKKLSPPVVETLPTVDLHEESSNAVVDSETVENISSSSTSEIT
PISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDASAPIEQPSFVSPPDSLVGQHIEN
VSSSHGKGKITKSEFESKVSASEQGGGDPKSALNASDNLKNESSDYTKPGDIDPTSVASP
KDPEDIPTFDEWKKKVMEVEKEKSQSMHASSNGGSHATKKVQKNRNNYASVECGAKILAA
NPEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQVKQLDIANYELFSSTPKDFLVS
ISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYVKVELLSHFGSEHFCPLSLIRVF
GTSMVEEYEEIADSQYHSERQELFDEDYDYPLDYNTGEDKSSKNLLGSATNAILNMVNIA
ANILGAKTEDLTEGNKSISENATATAAPKMPESTPVSTPVPSPEYVTTEVHTHDMEPSTP
DTPKESPIVQLVQEEEEEASPSTVTLLGSGEQEDESSPWFESETQIFCSELTTICCISSF
SEYIYKWCSVRVALYRQRSRTALSKGKDYLVSAQPPLLLPAESVDVSVLQPLSGLENKNI
EREAETVVLGDLSSSMHQDDLVNHTVDAVELEPSHSQTLSQSLLLDITPAINPLPKIEVS
ESVEYEAGHIPSQVIPQESSVEIDNEAEQKSESFSSIEKPSITYETNKVNELMDNIIKED
VNSMQIFTKLSETIVPPINTATVPDNEDGEAKMNIADTAKQTLISVVDSSSLPEVKEEEQ
SPEDALLRGLQRTATDFYAELQNSTDLGYANGNLVHGSNQKESVFMRLNNRIKALEVNMS
LSGRYLEELSQRYRKQMEEMQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQLLQAQLTNMT
QLVSNLSATVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSQFDGDYISKLPKS
NQYPSPKRCFSSYDDMNLKRRTSFPLMRSKSLQLTGKEVDPNDLYIVEPLKFSPEKKKKR
CKYKIEKIETIKPEEPLHPIANGDIKGRKPFTNQRDFSNMGEVYHSSYKGPPSEGSSETS
SQSEESYFCGISACTSLCNGQSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKSGSLPSL
HDIIKGNKEITVGTFGVTAVSGHI
Download sequence
Identical sequences ENSGGOP00000004102 ENSGGOP00000004102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]