SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004136 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004136
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1157
Classification Level Classification E-value
Superfamily E set domains 9.34e-37
Family Filamin repeat (rod domain) 0.00000487
Further Details:      
 
Domain Number 3 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 3.67e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 4 Region: 1843-1955
Classification Level Classification E-value
Superfamily E set domains 3.89e-36
Family Filamin repeat (rod domain) 0.00000345
Further Details:      
 
Domain Number 5 Region: 1522-1641
Classification Level Classification E-value
Superfamily E set domains 1.53e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 6 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 9.23e-33
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 
Domain Number 7 Region: 1435-1542
Classification Level Classification E-value
Superfamily E set domains 2e-32
Family Filamin repeat (rod domain) 0.0000269
Further Details:      
 
Domain Number 8 Region: 1142-1254
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.000075
Further Details:      
 
Domain Number 9 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 10 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 1.15e-29
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 11 Region: 554-666
Classification Level Classification E-value
Superfamily E set domains 4.54e-29
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 12 Region: 670-766
Classification Level Classification E-value
Superfamily E set domains 5e-29
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 13 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 14 Region: 2233-2328
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 15 Region: 279-392
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 16 Region: 1630-1742
Classification Level Classification E-value
Superfamily E set domains 8.53e-26
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 17 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 1.13e-25
Family Filamin repeat (rod domain) 0.0000109
Further Details:      
 
Domain Number 18 Region: 757-870
Classification Level Classification E-value
Superfamily E set domains 8.01e-25
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 
Domain Number 19 Region: 2555-2646
Classification Level Classification E-value
Superfamily E set domains 1.4e-24
Family Filamin repeat (rod domain) 0.000018
Further Details:      
 
Domain Number 20 Region: 2334-2425
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 21 Region: 378-474
Classification Level Classification E-value
Superfamily E set domains 5.88e-22
Family Filamin repeat (rod domain) 0.00083
Further Details:      
 
Domain Number 22 Region: 2156-2250
Classification Level Classification E-value
Superfamily E set domains 4.4e-21
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 23 Region: 958-1064
Classification Level Classification E-value
Superfamily E set domains 7.01e-20
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 24 Region: 1961-2058
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000933
Further Details:      
 
Domain Number 25 Region: 1785-1860
Classification Level Classification E-value
Superfamily E set domains 6.09e-16
Family Filamin repeat (rod domain) 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004136   Gene: ENSGGOG00000004199   Transcript: ENSGGOT00000004238
Sequence length 2647
Comment pep:known_by_projection chromosome:gorGor3.1:X:152309052:152335128:-1 gene:ENSGGOG00000004199 transcript:ENSGGOT00000004238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVAVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDIGKDQEFTVKSKGAGGQGKVASKIVGPSGGAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTIADNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSSAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
Download sequence
Identical sequences G3QNL9
XP_004065162.1.27298 ENSGGOP00000004136 ENSGGOP00000004136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]