SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004157 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004157
Domain Number 1 Region: 68-277
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.41e-69
Family alpha-catenin/vinculin 0.00042
Further Details:      
 
Domain Number 2 Region: 556-727
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.04e-42
Family alpha-catenin/vinculin 0.0085
Further Details:      
 
Domain Number 3 Region: 392-524
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.94e-37
Family alpha-catenin/vinculin 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004157
Domain Number - Region: 291-395
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0209
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004157   Gene: ENSGGOG00000004228   Transcript: ENSGGOT00000004259
Sequence length 734
Comment pep:known_by_projection chromosome:gorGor3.1:9:91286828:91359914:-1 gene:ENSGGOG00000004228 transcript:ENSGGOT00000004259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKK
SDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDI
TNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMER
LEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARTVLEKCTMMLLT
ASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSISIFTGIKEFK
MNIEALRENLYFQSKENLSVTLEVILERTEDFTDSAYTSHEHRERILELSTQARMELQQL
ISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA
LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQ
IISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLP
KPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
SSMAYSLYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKDDDKLMLLLEI
NKLIPLCHQLQTVTKTSLQNKVFLKVDKCITKTRSMMALLVQLLSLCYKLLKKLQMENNG
WVSVTNKDTMDGKT
Download sequence
Identical sequences G3QNN9
ENSGGOP00000004157 XP_004048459.1.27298 ENSGGOP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]