SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004158
Domain Number 1 Region: 265-371
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.84e-27
Family Cystatins 0.0054
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Cystatin/monellin 5.86e-24
Family Cystatins 0.026
Further Details:      
 
Domain Number 3 Region: 25-127
Classification Level Classification E-value
Superfamily Cystatin/monellin 8.26e-24
Family Cystatins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004158   Gene: ENSGGOG00000004236   Transcript: ENSGGOT00000004260
Sequence length 644
Comment pep:known_by_projection chromosome:gorGor3.1:3:188169619:188195705:1 gene:ENSGGOG00000004236 transcript:ENSGGOT00000004260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCDYKDSAEAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPVLRHGIQYFNNNTQHSSLFTLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSQIGEIKEETTVSPPHTSMAPAQDEERDSG
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHQQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPIPPAPTQSDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLADAFS
Download sequence
Identical sequences G3QNP0
ENSGGOP00000026889 ENSGGOP00000004158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]