SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004175 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004175
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-29
Family Pyk2-associated protein beta ARF-GAP domain 0.0033
Further Details:      
 
Domain Number 2 Region: 231-338
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 108-226
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004175   Gene: ENSGGOG00000004257   Transcript: ENSGGOT00000004278
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:5:53303436:53338277:-1 gene:ENSGGOG00000004257 transcript:ENSGGOT00000004278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISR
VKSVRLDFWDDSIVEVAVVLQFMIHNGNLRVKAKFEARVPAFYYIPQANDCNREGFLWKR
GRDNSQFLRRRFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGLQITY
RRDGHTRNLFVYHESGKEIVDWFNALRAARLQYLKMAFPELPESELVPFLTRNYLKQGFM
EKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEVYEDLPKGIR
GNRWKAGLTIVTPERRFVLTCPNEKEQQEWLESLRGVLSSPLTPLNRL
Download sequence
Identical sequences ENSGGOP00000004175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]