SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004194 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004194
Domain Number 1 Region: 245-525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.31e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000808
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-28
Family SH2 domain 0.0000112
Further Details:      
 
Domain Number 3 Region: 94-215
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-25
Family SH2 domain 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004194   Gene: ENSGGOG00000004276   Transcript: ENSGGOT00000004297
Sequence length 626
Comment pep:known_by_projection chromosome:gorGor3.1:12:7148262:7162433:1 gene:ENSGGOG00000004276 transcript:ENSGGOT00000004297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSG
DFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGG
QAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTV
GGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESED
TAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPG
SDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGR
NKCVPYWPEVGMQRVYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWP
DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGL
DCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGN
ITYPPAMKNAHAKASRTSSKSLESSAGTVAGSPVRWGGQRGLPVPGPPVLSPDLHQLPVL
APLHPAADTRRMCMRTCTLRTRGRRK
Download sequence
Identical sequences ENSGGOP00000004194 ENSGGOP00000004194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]