SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004195 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004195
Domain Number 1 Region: 395-537
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 291-396
Classification Level Classification E-value
Superfamily Second domain of FERM 9.81e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 3 Region: 210-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.47e-26
Family First domain of FERM 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004195   Gene: ENSGGOG00000004272   Transcript: ENSGGOT00000004298
Sequence length 869
Comment pep:known_by_projection chromosome:gorGor3.1:1:29999514:30130130:1 gene:ENSGGOG00000004272 transcript:ENSGGOT00000004298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECS
KIEVKEESPESKAERELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRVS
RSLDGAAAVDSADRSPRPTSAPAIAQGQVAEGGVLDGSAKKTAVPKAQKETVKAEVKKED
EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQIMAKQKLAEKTEDLIRMRKKKRERLD
GENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFR
TLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDN
NGDLDPGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLV
QAIKEAKEQHPDMSVTKVVVHQETEIADE
Download sequence
Identical sequences ENSGGOP00000004195 ENSGGOP00000004195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]