SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004196 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004196
Domain Number 1 Region: 382-507
Classification Level Classification E-value
Superfamily EF-hand 4.99e-45
Family EF-hand modules in multidomain proteins 0.00000905
Further Details:      
 
Domain Number 2 Region: 510-604
Classification Level Classification E-value
Superfamily EF-hand 1.5e-34
Family EF-hand modules in multidomain proteins 0.0000355
Further Details:      
 
Domain Number 3 Region: 586-672
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000116
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000157
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004196   Gene: ENSGGOG00000004271   Transcript: ENSGGOT00000004299
Sequence length 960
Comment pep:known_by_projection chromosome:gorGor3.1:X:98523196:98556297:1 gene:ENSGGOG00000004271 transcript:ENSGGOT00000004299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRAAVTSPAPPQDGAGVPCLS
LKLLNGSVGASGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEE
PHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSTTLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSQALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDRPSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEA
IQVPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRV
TIAEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYT
PTTSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMLPHADTH
SRIEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQAPCSVA
TESKGELQKILAHLEDENRWILQGELRRLKWQHEEAAEAPSLADGSTEAAPDHRNEELLA
EARILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQ
SEGSHPREKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences ENSGGOP00000004196 ENSGGOP00000004196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]