SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004209 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004209
Domain Number 1 Region: 18-189
Classification Level Classification E-value
Superfamily EF-hand 6.77e-34
Family Calmodulin-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004209   Gene: ENSGGOG00000004293   Transcript: ENSGGOT00000004312
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:16:24398787:24403099:1 gene:ENSGGOG00000004293 transcript:ENSGGOT00000004312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
Download sequence
Identical sequences G3QNT3 H2NQF4 H2QAS5 O43745
ENSP00000300113 NP_071380.1.87134 NP_071380.1.92137 XP_002826288.1.23681 XP_003813748.1.60992 XP_004057409.1.27298 gi|11545811|ref|NP_071380.1| 9598.ENSPTRP00000013478 9600.ENSPPYP00000008138 9606.ENSP00000300113 ENSPPYP00000008138 ENSPTRP00000013478 ENSP00000300113 ENSPTRP00000013478 ENSPPYP00000008138 ENSP00000300113 ENSGGOP00000004209 ENSGGOP00000004209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]