SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004215 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004215
Domain Number 1 Region: 172-343
Classification Level Classification E-value
Superfamily E set domains 1.12e-31
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-171
Classification Level Classification E-value
Superfamily E set domains 1.54e-27
Family Arrestin/Vps26-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004215   Gene: ENSGGOG00000004294   Transcript: ENSGGOT00000004318
Sequence length 414
Comment pep:known_by_projection chromosome:gorGor3.1:5:74217085:74231647:-1 gene:ENSGGOG00000004294 transcript:ENSGGOT00000004318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYAEVVTEEQRRN
NLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR
Download sequence
Identical sequences A0A2J8TD34 G3QNT9 Q96B67
ENSP00000265138 ENSP00000265138 ENSGGOP00000004215 9606.ENSP00000265138 NP_065852.1.87134 NP_065852.1.92137 XP_004042314.1.27298 ENSP00000265138 ENSGGOP00000004215 gi|32698736|ref|NP_065852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]