SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004257 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004257
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 3.02e-30
Family Calmodulin-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004257   Gene: ENSGGOG00000004340   Transcript: ENSGGOT00000004360
Sequence length 187
Comment pep:known_by_projection chromosome:gorGor3.1:19:16472988:16485213:-1 gene:ENSGGOG00000004340 transcript:ENSGGOT00000004360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRVFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGELSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
STFHIRI
Download sequence
Identical sequences G3QNX7
XP_004060268.1.27298 ENSGGOP00000004257 ENSGGOP00000004257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]