SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004265 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004265
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.98e-22
Family SNARE fusion complex 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004265   Gene: ENSGGOG00000004345   Transcript: ENSGGOT00000004368
Sequence length 100
Comment pep:known_by_projection chromosome:gorGor3.1:1:7904020:7912441:1 gene:ENSGGOG00000004345 transcript:ENSGGOT00000004368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF
ETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
Download sequence
Identical sequences G2HIJ9 G3S2Y3 H2N996 Q15836 Q6FGG2
9600.ENSPPYP00000002240 9606.ENSP00000054666 ENSPPYP00000002240 ENSPTRP00000000191 ENSPPYP00000002240 gi|4759300|ref|NP_004772.1| ENSP00000054666 ENSP00000054666 NP_001233512.1.37143 NP_004772.1.87134 NP_004772.1.92137 XP_002811600.1.23681 XP_003822184.1.60992 XP_004024633.1.27298 ENSP00000054666 ENSGGOP00000004265 ENSGGOP00000004265 ENSPTRP00000000191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]