SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004285 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004285
Domain Number 1 Region: 109-175
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000186
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 292-358
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000201
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004285
Domain Number - Region: 183-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0149
Family Nucleotide and nucleoside kinases 0.092
Further Details:      
 
Domain Number - Region: 100-114
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004285   Gene: ENSGGOG00000004368   Transcript: ENSGGOT00000004390
Sequence length 362
Comment pep:known_by_projection chromosome:gorGor3.1:7:155330798:155364262:1 gene:ENSGGOG00000004368 transcript:ENSGGOT00000004390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAII
DTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQ
GDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRNNQYQTRVIHD
GARLFRIKCVTRIQAYWRGYVVRKWYRNLRKTVPPTDAKLRKKFFEKKFTEISHRILCSY
NTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEKIQVQTLRRETHECSICLAPL
SPAGGQRVGTGRRSREMALLSCSHVFHHACLLALEEFSVGDGPPFHACPLCRSCYQKKIL
EC
Download sequence
Identical sequences ENSGGOP00000004285 ENSGGOP00000004285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]