SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004308 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004308
Domain Number 1 Region: 131-256
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-33
Family DEP domain 0.0062
Further Details:      
 
Domain Number 2 Region: 43-126
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-29
Family DEP domain 0.0011
Further Details:      
 
Domain Number 3 Region: 323-405
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000101
Family PDZ domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004308   Gene: ENSGGOG00000004394   Transcript: ENSGGOT00000004415
Sequence length 409
Comment pep:known_by_projection chromosome:gorGor3.1:8:119422413:119603460:1 gene:ENSGGOG00000004394 transcript:ENSGGOT00000004415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC
Download sequence
Identical sequences G3QP24 H2QWM8 Q8TB45
gi|189571664|ref|NP_073620.2| 9598.ENSPTRP00000035125 9606.ENSP00000286234 ENSP00000286234 NP_073620.2.87134 NP_073620.2.92137 XP_003822647.1.60992 XP_018888415.1.27298 XP_519926.3.37143 ENSGGOP00000004308 ENSGGOP00000004308 ENSPTRP00000035125 ENSP00000286234 ENSPTRP00000035125 ENSP00000286234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]