SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004309 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004309
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.31e-37
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004309   Gene: ENSGGOG00000004395   Transcript: ENSGGOT00000004416
Sequence length 188
Comment pep:known_by_projection chromosome:gorGor3.1:22:14762572:14767002:-1 gene:ENSGGOG00000004395 transcript:ENSGGOT00000004416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQIAMVINVSVEVVNTL
YEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEK
EVRLMIPL
Download sequence
Identical sequences XP_004063352.1.27298 XP_018874252.1.27298 XP_018874253.1.27298 ENSGGOP00000004309 ENSGGOP00000004309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]