SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004334 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004334
Domain Number 1 Region: 85-274
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.21e-56
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 274-389
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 8.25e-26
Family HCDH C-domain-like 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004334   Gene: ENSGGOG00000004423   Transcript: ENSGGOT00000004441
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:4:117357242:117400725:1 gene:ENSGGOG00000004423 transcript:ENSGGOT00000004441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGLEAPPPSCGVTVTPGARGLQGRVGPRPQSLAFRGNPPRASSPSASARCRRRCHTM
AFVTRQFMRSMSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTED
ILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIV
ENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFGGLHFFNPVPVMKLV
EVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERDSQTC
GDSNLGLGFSLKGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDTEN
PLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Download sequence
Identical sequences A0A2I2YIT9
ENSGGOP00000004334 ENSGGOP00000004334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]