SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004341 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004341
Domain Number 1 Region: 8-248
Classification Level Classification E-value
Superfamily HAD-like 1.03e-41
Family beta-Phosphoglucomutase-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004341   Gene: ENSGGOG00000004425   Transcript: ENSGGOT00000004448
Sequence length 251
Comment pep:known_by_projection chromosome:gorGor3.1:X:6813048:6910515:-1 gene:ENSGGOG00000004425 transcript:ENSGGOT00000004448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPQPVTHLIFDMDGLLLGYTGSIVAAASGESSRGLQSQWKDTERLYSVVFQEICDRY
DKKYSWDVKSLVMGKKALEAAQIIIDILQLPMSKEELVEESRTKLKEVFPTAALMPGAEK
LIIHLRKHGIPFALATSSGSVSFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLA
CAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDF
QPELFGLPPYE
Download sequence
Identical sequences G3QP56
ENSGGOP00000004341 XP_004063801.1.27298 ENSGGOP00000027415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]