SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004358 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000004358
Domain Number - Region: 5-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0463
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004358   Gene: ENSGGOG00000004438   Transcript: ENSGGOT00000004465
Sequence length 810
Comment pep:known_by_projection chromosome:gorGor3.1:1:183834972:183871075:1 gene:ENSGGOG00000004438 transcript:ENSGGOT00000004465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRQVCRFRHMEIDKK
RSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSV
QQNKLSVQSNPSPQLRSVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTP
TLQPTPEVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIKSXXXXXXXLPYSEGSSGVS
SLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLK
RSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMAADPNNEDATDKVNKVGEIHVKT
LEEILLERASQKRGELQTKLKTEGPSKTDDSTSGARSSSTVRIKTFSEVLAEKKHRQQEA
ERQKSKKDTTCIKLKIDSEIKKTVVLPPIVASKGQSEEPAGKTKSMQEVHIKTLEEIKLE
KALRVQQSSESSTSSLSQHEATPGARRLLRITKRTGMKEEKNLQEGNEVDSQSSIRTEAK
EASGETTGVDITKIQVKRCETMREKHMQKQQEREKSVLTPLRGDVASCNTQVAEKPVLTA
VPGITRHLTKRLPTKSSQKVEVETSGIGDSLLNVKCAAQTLEKRGKAKPKVNVKPSVVKV
VSSPKLAPKRKAVEMHGAVIAAVKPLSSSSVLQEPPAKKAAVAVVPLVSEDKSVTVPEAE
NPRDSLVLPPTQSSSDSSPPEVSGPSSSQMSMKTRRLSSASTGKPPLSVEDDFEKLIWEI
SGGKLEAEVDLDPGKDEDDLLLELSEMIDS
Download sequence
Identical sequences ENSGGOP00000004358 ENSGGOP00000004358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]