SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004379
Domain Number 1 Region: 18-153
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.81e-19
Family Chaperone J-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 553-606
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000145
Family Myb/SANT domain 0.0056
Further Details:      
 
Domain Number 3 Region: 450-504
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000104
Family Myb/SANT domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004379   Gene: ENSGGOG00000004459   Transcript: ENSGGOT00000004487
Sequence length 621
Comment pep:known_by_projection chromosome:gorGor3.1:7:100853117:100874643:-1 gene:ENSGGOG00000004459 transcript:ENSGGOT00000004487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPCDTLKPLLTLSITASTLCRVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDE
ELQLEEFPMLKTLDPKDWKQNYSFYAILGVSIIRRTVAEAVVKGCSHKAMVLKHHPDKRK
AAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTP
VFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDER
RWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKTIIRKQRTSFYWAKNCVISS
FNTMLISNMQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKT
WNHFSDNEAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINEQI
RKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIAN
YMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSE
RFEDTGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELV
EMVKAKKAAQEQVLNASRAKK
Download sequence
Identical sequences ENSGGOP00000004379 ENSGGOP00000004379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]