SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004388 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004388
Domain Number 1 Region: 56-460
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-90
Family Ras GEF 0.00099
Further Details:      
 
Domain Number 2 Region: 528-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004388
Domain Number - Region: 467-499
Classification Level Classification E-value
Superfamily EF-hand 0.00195
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004388   Gene: ENSGGOG00000004473   Transcript: ENSGGOT00000004497
Sequence length 673
Comment pep:known_by_projection chromosome:gorGor3.1:19:35784853:35800976:-1 gene:ENSGGOG00000004473 transcript:ENSGGOT00000004497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDSKRKSHQECTGKTGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHGDHMLNMVLAMHSWVLPSADLAARLLTSYYQKATGDTQELRRL
QICHLVRYWLTRHPEVMHQDPQLEEVIGRFWATVAQEGNSAQRRLGDSSNLLSPGGPGPP
LPMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPA
LEGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLRQLQNFNTLMAVTGGLCH
SAISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLV
SLHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTE
DEIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYD
PEGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAF
LHTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGD
AGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSETDTVPCPV
MDPPSTASSKLDS
Download sequence
Identical sequences ENSGGOP00000004388 ENSGGOP00000020614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]