SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004395
Domain Number 1 Region: 220-381
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.77e-39
Family Pentapeptide repeats 0.00028
Further Details:      
 
Domain Number 2 Region: 90-193
Classification Level Classification E-value
Superfamily POZ domain 2.94e-25
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 
Domain Number 3 Region: 2-77
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000249
Family Doublecortin (DC) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004395   Gene: ENSGGOG00000004480   Transcript: ENSGGOT00000004504
Sequence length 392
Comment pep:known_by_projection chromosome:gorGor3.1:8:25375134:25407222:-1 gene:ENSGGOG00000004480 transcript:ENSGGOT00000004504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFLNGSPKNGKVVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDD
DVLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRILRSTLVNKEPDSML
AHMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFG
IDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLR
YINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFE
DPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNKLKNCNLRGATLAGTDLENCDLSG
CDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences ENSGGOP00000004395 ENSGGOP00000004395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]