SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004398 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004398
Domain Number 1 Region: 659-823
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-42
Family DBL homology domain (DH-domain) 0.000000896
Further Details:      
 
Domain Number 2 Region: 831-960
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-35
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 328-466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 135-231
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000759
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004398   Gene: ENSGGOG00000004477   Transcript: ENSGGOT00000004507
Sequence length 1070
Comment pep:known_by_projection chromosome:gorGor3.1:X:137223338:137335632:-1 gene:ENSGGOG00000004477 transcript:ENSGGOT00000004507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQAAASARWTSVSCGRIPGLPQNPNGCTFMPIAQAIPLQVDMAMALQRVRIAEKYGKNY
LCLLQAVFVAETDLLLRIKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVI
AKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSF
LQRTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFR
NAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKE
GKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKME
QYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKA
QFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQAR
QCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPE
LKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGAPFFSSKQG
KKTWRQNQSNLKIEVVHDCQEKRSSGQSSSLDNGNSLDVLKKYPLNRVVHQKLQMIIQID
TITLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDALFTSLLYFAHAPERVG
PCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRI
TKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMI
MQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFK
HCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELL
TVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELEHTSPVVEVCEAIASVQAEA
NTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMALLY
Download sequence
Identical sequences ENSGGOP00000004398 ENSGGOP00000004398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]