SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004404 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004404
Domain Number 1 Region: 104-245
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-34
Family C-type lectin domain 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004404   Gene: ENSGGOG00000004490   Transcript: ENSGGOT00000004514
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:12:10157377:10169085:-1 gene:ENSGGOG00000004490 transcript:ENSGGOT00000004514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYHPDLENLDEDGYTQLHFDSRSNTRIAVVSEKGLCTASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCSQLGSNLLKIDSSNELGFIVQQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQMCSVPSYSI
CEKKFSM
Download sequence
Identical sequences A0A2I2ZXP5
ENSGGOP00000004404 ENSGGOP00000004404 XP_004052742.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]