SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004418 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004418
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily EF-hand 2.47e-19
Family S100 proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004418   Gene: ENSGGOG00000004511   Transcript: ENSGGOT00000004528
Sequence length 772
Comment pep:known_by_projection chromosome:gorGor3.1:1:131113300:131118293:-1 gene:ENSGGOG00000004511 transcript:ENSGGOT00000004528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLLNSILSVIEVFHKYAKGNGDCALLCKEELKQLLLAEFGDILQRPNDPETVETILNL
LDQDRDGHIDFHEYLLLVFQLVQACYRKLDNKSHGGRTSQQERGQEGAQDRKFPGNTGRQ
HRQRHEEERQNSHHSQPERQDGDSHRGQPERQDRDSHHGQSDKQDRDSHHGQPERQDRDS
HHNQSERQDKDFSFDQSEKQSQDSSSGKKVSHKSTSGQAKWQGHIFALNRCEKPIQDSHY
GQSERLTQQSETLGQASHFNQTNQQKSGSYCGQSERLGQELGCGQTDRQGQSSHYGQTDR
QDQSYHYDHTDRQGQSSHYSQTDRQGQSSHYGQMDRKGQCYHYDQTDRQGQGSHYSQPNR
QGQSSHYGQPDTQGQSSHYGQTDRQDQSSHYGQTERQGQSSHYSQMDRQGQGSHYGQTDR
QGQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQRSHYSQPDRQGQSSHYGKTDR
QDHSYHYGQLDRQGQSSHYGQTDRQGQSFHYGQPDRQGQSSYYGQMDRQGQSSHYGQTDR
QGQSSHYGQTDRQGQSYHYGQTDRQGQSSHYIQSQTGDIQGQNKYFQGTEGTRKASHVEQ
SGRSGRLSQQTPGQEGYKNQGQGFQSRDSQQNGHQVWEPEEDSQHHQHKLLAQIQQERPL
CHKGREWQSCSSEQGHRQAQTRQSHGEGLSHWAEEEQGHQSWDRHSHESQEGPCGTQDRR
THEDEQNHQRRDRQTHEDEQNCQRRDRQTHEDEQNRQRRDTQTHEDEQNHQR
Download sequence
Identical sequences ENSGGOP00000004418 ENSGGOP00000004418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]