SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004441 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004441
Domain Number 1 Region: 269-387
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.5e-27
Family DNA polymerase beta-like 0.00042
Further Details:      
 
Domain Number 2 Region: 137-228
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 9.29e-26
Family DNA polymerase beta, N-terminal domain-like 0.00036
Further Details:      
 
Domain Number 3 Region: 30-120
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000174
Family DNA topoisomerase II binding protein 1, TopBP1 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004441   Gene: ENSGGOG00000004529   Transcript: ENSGGOT00000004551
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:7:45036500:45045956:-1 gene:ENSGGOG00000004529 transcript:ENSGGOT00000004551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKRRRARVGSPSGDAASSTPPSTCFPGVAIYLVEPRMGRSRRAFLTRLARSKGFRVLD
ACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECR
HRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTGLSEALETLAEAAGFEGSEGRLLTFC
RAASVLKALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERAPAPPGP
EHPSPAVRCRCPAAGGGGSCGAGPAWGHRHADRRLPQGLILYHQHQHSCWESPTRLAQQS
HMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAMRVDLVVAPVSQFPFALLGWTGSKLF
QRELRRFSRKEKGLWLNSHGLFDPEQGSSSGKTPRSRKSCFCCRRHFSKRLQRKTSSDTW
ASSTFLQSRETPEPACVPHFHSGNWAAPNLATECLQADMLPPDPHLHPSPPRPGSSGGQL
CLKDQLSPCWCAAGCDEVGALSASLITV
Download sequence
Identical sequences G3QPE8
ENSGGOP00000004441 XP_018887158.1.27298 ENSGGOP00000026396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]