SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004484 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004484
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-33
Family C-type lectin domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 47-74
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000785
Family Triple coiled coil domain of C-type lectins 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004484   Gene: ENSGGOG00000004576   Transcript: ENSGGOT00000004599
Sequence length 202
Comment pep:known_by_projection chromosome:gorGor3.1:3:46185407:46195172:1 gene:ENSGGOG00000004576 transcript:ENSGGOT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWGAYHLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVAL
LKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEY
LRQSVGNEAEIWLGLNDMAAEGSWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAA
NGKWFDKRCRDQLPYICQFGIV
Download sequence
Identical sequences G3QPI9
XP_004034030.1.27298 ENSGGOP00000004484 ENSGGOP00000004484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]