SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004536 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004536
Domain Number 1 Region: 400-510
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-27
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-23
Family PDZ domain 0.00054
Further Details:      
 
Domain Number 3 Region: 210-300
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-17
Family PDZ domain 0.041
Further Details:      
 
Domain Number 4 Region: 693-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000248
Family Nucleotide and nucleoside kinases 0.0019
Further Details:      
 
Domain Number 5 Region: 511-587
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000614
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004536   Gene: ENSGGOG00000004626   Transcript: ENSGGOT00000004654
Sequence length 856
Comment pep:known_by_projection chromosome:gorGor3.1:19:3808751:3832480:1 gene:ENSGGOG00000004626 transcript:ENSGGOT00000004654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCGLMPIFPVPLDQVADMEELTIWEQHTATLSKDPRRGFGIAISGGRDRPGGSVIVSD
VVPGGPAEGRLQTGDHIVMVNGVSVENATSAFAIQILKTCTKMANITVKRPRRIHLPATK
ASPSSPGRQDSDEDDGPQRVEEMDQGRGYDGDSSSGSGRSWDERSRRPRPGRRGRAGSHG
RRSPGGGSEANGLALVSGFKRLPRQDVQMKPVKSVLVKRRDSEEFGVKLGSQIFIKHITD
SGLAARHRGLQEGDLILQINGVSSQNLSLNDTRRLIEKSEGKLSLLVLRDRGQFLVNIPP
AVSDSDSSPLEEGVTMANEMSSPPADISDLASELSQAPPSHIPPPPRHAQRSPEASQTDS
PVESPRLRRESSVDSRTISETEEQRSELPRESSYDIYRVPSSQSMEDRGYSPDTRVVCFL
KGKSIGLRLAGGNDVGIFVSGVQAGSPADGQGIQEGDQILQVNDVPFQNLTREEAVQFLL
GLPPGEEMELVTQRKQDIFWKMVQSRVGDSFYIRTHFELEPSPPSGLGFTRGDVFHVLDT
LHPGPGQSHARGGHWLAVRMGHDLREQERGIIPNQSRAEQLASLEAAQRAVGVGPGSSAG
SNARAEFWRLRGLRRGAKKTTQRSREDLSALTRQGHYPPYERVVLREASFKRPVVILGPV
ADIAMQKLTAEMPDQFEIAETVSRTDSPSKIIKLDTVRVIAEKDKHALLDVTPSAIERLN
YVQYYPIVVFFIPESRPALKALRQWLAPASRRSTRRLYAQAQKLRKHSSHLFTATIPLNG
TSDTWYQELKAIIREQQTRPIWTAEDQVDSRHPQGQWRQDSMRTYEREALKKKFTRVHDA
ESSDEDGYDWGPATDL
Download sequence
Identical sequences ENSGGOP00000004536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]