SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004541 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004541
Domain Number 1 Region: 213-358
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000275
Further Details:      
 
Domain Number 2 Region: 380-490
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-19
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 3 Region: 484-574
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000999
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004541   Gene: ENSGGOG00000004637   Transcript: ENSGGOT00000004659
Sequence length 582
Comment pep:known_by_projection chromosome:gorGor3.1:19:3832569:3843515:-1 gene:ENSGGOG00000004637 transcript:ENSGGOT00000004659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPAPGGPGSLSRMELDESSIQEL
VQQFEALPGDLVGPSPDGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWAEGASAEQEGSRSSSSSPEPWLETVP
LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFTAAYSQFLRES
GIDPSQVGAHPSPGAGHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
PPVTTAIIHRPHAREQLGXXXPASSFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQS
VVATPHARIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL
Download sequence
Identical sequences ENSGGOP00000004541 ENSGGOP00000004541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]