SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004565
Domain Number 1 Region: 472-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-38
Family Pentraxin (pentaxin) 0.00078
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily Chromo domain-like 1.16e-17
Family Chromo domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004565   Gene: ENSGGOG00000004660   Transcript: ENSGGOT00000004684
Sequence length 669
Comment pep:known_by_projection chromosome:gorGor3.1:22:23118224:23168340:-1 gene:ENSGGOG00000004660 transcript:ENSGGOT00000004684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
ERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLK
KDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV
IDKGEVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPG
PGLLLAAPAATYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLS
LPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSN
LLTVTIKEFCNPEDFEKQELPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEK
ERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPIRNNYMYARVRK
ALPELYAFTACMWLRSRSSGTGQGTPFSYSVPGQANEIVLLEAGHEPMELLINDKVAQLP
LSLKDNGWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGG
RFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAF
DVCKGRARA
Download sequence
Identical sequences ENSGGOP00000026059 ENSGGOP00000004565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]