SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004566 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004566
Domain Number 1 Region: 50-186,238-497
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 4.05e-117
Family Proton glutamate symport protein 0.000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004566   Gene: ENSGGOG00000004661   Transcript: ENSGGOT00000004685
Sequence length 542
Comment pep:known_by_projection chromosome:gorGor3.1:17:57023629:57105933:-1 gene:ENSGGOG00000004661 transcript:ENSGGOT00000004685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLLVAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
Download sequence
Identical sequences G3QPR7
ENSGGOP00000004566 XP_004058995.1.27298 ENSGGOP00000004566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]