SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004596 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004596
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-56
Family SPRY domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004596
Domain Number - Region: 139-234
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0209
Family Apolipoprotein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004596   Gene: ENSGGOG00000004692   Transcript: ENSGGOT00000004715
Sequence length 468
Comment pep:novel chromosome:gorGor3.1:4:175523476:175524882:1 gene:ENSGGOG00000004692 transcript:ENSGGOT00000004715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAALTGLQAEAKCSICLDYLSDPVTIECGHNFCRSCIQQSWLDLQELFPCPVCRHQC
QEGHFRSNTQLGRMIEIAKLLQSTKSNKRKQEETTLCEKHNQPLSVFCKEDLMVLCPLCT
QPPDHQGHHVRPIEKAAIHYRKRFCSYIQPLKKQLADLQKLISTQSKKPLELREMVENQR
QELSSEFEHLNQFLDREQQAVLSRLAEEEKDNQQKLSANITAFSNYSATLKSQLSKVVEL
SELSELELLSQIKIFYESENESSPSIFSIHLKRDGCSFPPQYSALQRIIKKFKVEIILDP
ETAHPNLIVSEDKKCVRFTKRKQKVPGFPKRFTVKPVVLGFPYFHSGRHFWEIEVGDKSE
WAIGICKDSLPTKARRPSSAQQECWRIELQDDGYHAPGAFPTPLLLEVKARAIGIFLDYE
MGEISFYNMAEKSHICTFTDTFTGPLRPYFYVGPNSQPLRICTGTVCE
Download sequence
Identical sequences G3QPU3
ENSGGOP00000004596 ENSGGOP00000004596 XP_018880781.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]